PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G20740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 230aa    MW: 25778.1 Da    PI: 6.9424
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G20740.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM103.92.1e-3271241128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGf+F P+deelvv++L++kv+  +++  ++i+++  ++++Pw+L+ k+ +  ++wyfF++  +        +r+ ++g W+  g d++v s
  OGLUM02G20740.1   7 LPPGFHFFPSDEELVVHFLRRKVSLLPCHP-DIIPTLLPHRYNPWELNGKALQAGNQWYFFCHLTQ--------SRTSSNGHWSPIGVDETVRS 91 
                      79*************************999.89**************966667789******9855........577789*************9 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g++vglkktL f  g+ ++g +t+W+mhey+l
  OGLUM02G20740.1  92 -GGRNVGLKKTLLFSIGEPSEGIRTNWIMHEYHL 124
                      .99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-444167IPR003441NAC domain
PROSITE profilePS5100540.57168IPR003441NAC domain
PfamPF023652.1E-208124IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGGATNLPPG FHFFPSDEEL VVHFLRRKVS LLPCHPDIIP TLLPHRYNPW ELNGKALQAG  60
NQWYFFCHLT QSRTSSNGHW SPIGVDETVR SGGRNVGLKK TLLFSIGEPS EGIRTNWIMH  120
EYHLLDGDCV AGGSSNLTSS SSNRRSHRKR GHSSMESNNW VLCRVFESSC GSQVSFHGEG  180
TELSCLDEVF LSLDDYDEKE KRKVGGAYAI IWPSMLSMEI MHACVEIALR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-32617316170NO APICAL MERISTEM PROTEIN
1ut4_B2e-32617316170NO APICAL MERISTEM PROTEIN
1ut7_A2e-32617316170NO APICAL MERISTEM PROTEIN
1ut7_B2e-32617316170NO APICAL MERISTEM PROTEIN
3swm_A2e-32617319173NAC domain-containing protein 19
3swm_B2e-32617319173NAC domain-containing protein 19
3swm_C2e-32617319173NAC domain-containing protein 19
3swm_D2e-32617319173NAC domain-containing protein 19
3swp_A2e-32617319173NAC domain-containing protein 19
3swp_B2e-32617319173NAC domain-containing protein 19
3swp_C2e-32617319173NAC domain-containing protein 19
3swp_D2e-32617319173NAC domain-containing protein 19
4dul_A2e-32617316170NAC domain-containing protein 19
4dul_B2e-32617316170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8313770.0CT831377.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRN119H17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626053.11e-146PREDICTED: NAC transcription factor 29
SwissprotQ8GWK61e-59NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A0D9YTM01e-172A0A0D9YTM0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA008422-PA1e-146(Oryza sativa Indica Group)
STRINGLOC_Os02g34970.11e-146(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36673679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.13e-59xylem NAC domain 1